Gamma-Synuclein

Gamma-Synuclein (originally known as a breast cancer specific gene product, BCSG1) is an acidic neuronal protein of 127 amino acids. It is up-regulated in the majority of late-stage breast and ovarian cancers. Gamma-synuclein may be a potential marker for both late-stage breast and ovarian cancers. More recently, it has been shown that gamma-synuclein promotes cancer cell survival and inhibits stress and chemotherapy drug-induced apoptosis by modulating MAP kinase pathways.

Catalog ID: S-1007-1

$300.00

  • Product Details

    • Size: 0.5 mg
    • Physical State: White lyophilized powder
    • Temperature Storage: -20°C
    • Temperature Shipping: Ambient
    • Sequence:
      MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
    • Source: Recombinant. A DNA sequence encoding the human gamma-synuclein sequence was expressed in E. coli.
    • Purity: >95% by SDS-PAGE and Mass Spec.
    • Molecular Mass: 13,300 Da theoretical
  • References

    1. Pan, Z., et al., (2002) J. Biol. Chem. 277 : 35050
    2. Bruening, W., et al., (2000) Cancer 88 : 2154
    3. Ji, H., et al., (1997) Cancer Res. 57 : 759

  • Publications

    Autoimmune antibody decline in Parkinson’s disease and Multiple System Atrophy; a step towards immunotherapeutic strategies.

    BioMedCentral; https://doi.org/10.1186/s13024-017-0187-7.

    Tomasz Brudek, Kristian Winge, Jonas Folke, Søren Christensen, Karina Fog, Bente Pakkenberg and Lars Østergaard Pedersen