Gamma-Synuclein
Gamma-Synuclein (originally known as a breast cancer specific gene product, BCSG1) is an acidic neuronal protein of 127 amino acids. It is up-regulated in the majority of late-stage breast and ovarian cancers. Gamma-synuclein may be a potential marker for both late-stage breast and ovarian cancers. More recently, it has been shown that gamma-synuclein promotes cancer cell survival and inhibits stress and chemotherapy drug-induced apoptosis by modulating MAP kinase pathways.
$300.00
-
Product Details
- Size: 0.5 mg
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
- Source: Recombinant. A DNA sequence encoding the human gamma-synuclein sequence was expressed in E. coli.
- Purity: >95% by SDS-PAGE and Mass Spec.
- Molecular Mass: 13,300 Da theoretical
-
References
1. Pan, Z., et al., (2002) J. Biol. Chem. 277 : 35050
2. Bruening, W., et al., (2000) Cancer 88 : 2154
3. Ji, H., et al., (1997) Cancer Res. 57 : 759 -
Publications
BioMedCentral; https://doi.org/10.1186/s13024-017-0187-7.