Beta-Amyloid (1-40), NH4OH
Product background: Beta-Amyloid peptides (A-beta), the major constituent of amyloid plaques in the brains of Alzheimer’s patients, is thought to be a primary contributor of Alzheimer’s Disease (AD).
About the product: Expressed recombinantly in E. coli, Beta-Amyloid (1-40) is purified to our highest standards to ensure batch to batch consistency in both purity and quality.
Applications: The NH4OH counter ion of our Aβ ensures a highly monomeric starting material that could be suited to aggregation studies, seeding experiments, molecular standards, and more.
$84.00
-
Product Details
- Size: .25 mg
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Source: Recombinant. A DNA sequence encoding the human beta-amyloid (1-40) sequence was expressed in E. coli
- Purity: >97% by Mass Spec.
- Molecular Mass: 4,329 Da theoretical
-
References
1. Yankner, B.A., et al., (1990) Science, 250 : 279-282
2. Stine, W.B., et al., (2003) J. Biol. Chem, 278 : 11612-11622
3. Frank, R.A., et al., (2003) Neurobiology of Aging, 24 : 521-536
4. Selkoe, D.J., (2001) Physiol. Rev, 81 : 741-766
5. Benoit, S., (2020) Scientific Reports, 11 : 6622
