FITC Beta-Amyloid (1-40)
Product background: Beta-Amyloid peptides (A-beta), the major constituent of amyloid plaques in the brains of Alzheimer’s patients, are thought to be a primary contributor to Alzheimer’s Disease (AD).
About the product: Expressed recombinantly in E. coli, Beta-Amyloid (1-40) is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality. rPeptide’s human Beta-Amyloid has been covalently labeled with Fluorescein Isothiocyanate on the side chain of lysine residues.
Applications: This FITC labeled form of Beta-Amyloid (1-40) is ideally suited to localization experiments, aggregation monitoring and other fluorescence based studies without the need for mutations or further labeling.
$520.00 – $810.00
-
Product Details
- Physical State: White lyophilized powder
- Temperature Storage: -20°C
- Temperature Shipping: Ambient
- Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Source: Recombinant. A DNA sequence encoding the human Beta-Amyloid (1-40) sequence was expressed in E. coli and had FITC molecules attached for fluorescence.
- Purity: >95% by Mass Spec.
- Molecular Mass: Approximately 4,330 Da to 5,108 Da
-
References
1. Jin, S., et al., (2016) Journal of Biological Chemistry. 291 : 19590-19606
2. Jamasbi, E., et al., (2018) Biochimica et Biophysica Acta (BBA) 1860(9) : 1609- 1615
3. Jungbauer, L.M., et al., (2009) J Mol Recognit. 22(5) : 403-413 -
Publications
Science Direct (2025), 262. DOI: 10.1016/j.exer.2025.110759.