We understand these are trying times and we are here to help keep your research moving forward.

As we closely monitor the situation at hand, rPeptide will remain fully operational and continue to practice all safety protocol while taking precautionary measures to ensure there are no interruptions to your research. From our catalog products to our laboratory services, please let us know how we can assist with your research needs.

Alpha-Synuclein, Monkey

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha-Synuclein, Monkey
Size
Catalog #
S-1021-1
Storage
-20C
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Source
Recombinant. A DNA sequence encoding the monkey alpha-synuclein, was expressed in E. coli.
Description
Alpha-Synuclein (a-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of Parkinson's disease aggregates and is implicated in the pathogenesis of Parkinson's Disease and related neurodegenerative disorders. a-Synuclein accumulates in the brains of sporadic Parkinson's disease patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of Parkinson's disease. a-Synuclein appears to associate with other proteins that aggregate and is found in B-amyloid plaques and neuritic tangles in Alzheimer's disease3. Monkey alpha-Synuclein has a 98% homologous sequence to Human Alpha-Synuclein.
Molecular Mass
14.47kDa by Mass Spec. Analysis (14.47kDa theoretical)
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$300
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Conway, K.A. et. al., (2000) Biochemistry, 39: 2552
2) Jakes, R. et al. (1994), FEBS Letters, 345: 27
3) Masliah, E. et. al., (2001) Proc. Natl. Acad. Sci., USA, 98: 12245
4) Ueda, K., et. al. (1993) Proc. Natl. Acad. Sci., USA, 90: 11282