Product Name
Alpha Synuclein Mutant S9C
Size
Catalog #
S-1017-1
Storage
-20C
Sequence
MDVFKKGFCIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Source
Recombinant. A DNA sequence encoding the human alpha synuclein mutant S9C, was expressed in E. coli.
Description
This human alpha synuclein contain a mutation at S9C that can be used for thiol coupling or thiol modification. The S9C mutant is compatible with haloalkyl derivatives, maleimides, and sulfonates. Possible applications include fluorescence labeling 1 , spin labeling for EPR2 or PRE experiments 3 .
Molecular Mass
14.5kDa by Mass Spec. Analysis
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$300
Place an Order
Would you like 10 or more? Save on cost by requesting a Large Quantity Quote.
1. Daniels, M.J., Nourse, J.B., Kim, H. et al. Sci Rep 9, 2937 (2019).
2. Drescher M, Godschalk F, Veldhuis G. et al. Chembiochem. 2008 Oct 13;9(15):2411-6.
3. Rospigliosi CC, McClendon S, Schmid AW, et al. J Mol Biol. 2009;388(5):1022-1032.
2. Drescher M, Godschalk F, Veldhuis G. et al. Chembiochem. 2008 Oct 13;9(15):2411-6.
3. Rospigliosi CC, McClendon S, Schmid AW, et al. J Mol Biol. 2009;388(5):1022-1032.