We understand these are trying times and we are here to help keep your research moving forward.

As we closely monitor the situation at hand, rPeptide will remain fully operational and continue to practice all safety protocol while taking precautionary measures to ensure there are no interruptions to your research. From our catalog products to our laboratory services, please let us know how we can assist with your research needs.

Alpha Synuclein Mutant S9C

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha Synuclein Mutant S9C
Size
Catalog #
S-1017-1
Storage
-20C
Sequence
MDVFKKGFCIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Source
Recombinant. A DNA sequence encoding the human alpha synuclein mutant S9C, was expressed in E. coli.
Description
This human alpha synuclein contain a mutation at S9C that can be used for thiol coupling or thiol modification. The S9C mutant is compatible with haloalkyl derivatives, maleimides, and sulfonates. Possible applications include fluorescence labeling 1 , spin labeling for EPR2 or PRE experiments 3 .
Molecular Mass
14.5kDa by Mass Spec. Analysis
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$300
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1. Daniels, M.J., Nourse, J.B., Kim, H. et al. Sci Rep 9, 2937 (2019).

2. Drescher M, Godschalk F, Veldhuis G. et al. Chembiochem. 2008 Oct 13;9(15):2411-6.

3. Rospigliosi CC, McClendon S, Schmid AW, et al. J Mol Biol. 2009;388(5):1022-1032.