Alpha-Synuclein, 96-140

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha-Synuclein, 96-140
Size
Catalog #
S-1014-2
Storage
–20°C
Sequence
KKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSE EGYQDYEPEA
Source
Recombinant. A DNA sequence encoding the human alpha-synuclein (96-140) sequence was expressed in E. coli. No additional Met amino acid is attached at the N-terminus.
Description
A deletion mutant of a-synuclein (amino acids 96-140). Alpha-Synuclein (a-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of Parkinson's disease aggregates and is implicated in the pathogenesis of Parkinson's Disease and related neurodegenerative disorders. a-Synuclein accumulates in the brains of sporadic Parkinson's disease patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of Parkinson's disease. a-Synuclein appears to associate with other proteins that aggregate and is found in a-amyloid plaques and neuritic tangles in Alzheimer's disease,6. This product has been produced without a methionine (M) at the start of the sequence to provide our customers with a more native, physiologically relevant product.
Molecular Mass
5087.2 Da
Purity
>95% by SDS-PAGE
Cost (US$)
$500
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Park, S. M. et al. (2002) Blood, 100(7) 2506
2) Park, S. M. et al. (2002) Biochemisty. 41, 4137
3) Conway, K.A. et. al., (2000) Biochemistry, 39: 2552
4) Jakes, R. et al. (1994), FEBS Letters, 345: 27
5) Masliah, E. et. al., (2001) Proc. Natl. Acad. Sci., USA, 98: 12245
6) Ueda, K., et. al. (1993) Proc. Natl. Acad. Sci., USA, 90: 11282