Alpha-Synuclein, 1-60

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha-Synuclein, 1-60
Size
0.5 mg
Catalog #
S-1011-1
Storage
-20°C
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYV GSKTKEGVVHGVATVAEKTK
Source
Recombinant. A DNA sequence encoding the human alpha-synuclein (1-60) sequence was expressed in E. coli.
Description
A deletion mutant of α-synuclein (amino acids 1-60), which contains the N-terminal amphipathic domain, 2,4 . Alpha-Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of Parkinson’s disease aggregates and is implicated in the pathogenesis of Parkinson’s Disease and related neurodegenerative disorders. α-Synuclein accumulates in the brains of sporadic Parkinson’s disease patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of Parkinson’s disease. α-Synuclein appears to associate with other proteins that aggregate and is found in β-amyloid plaques and neuritic tangles in Alzheimer’s disease 3 .
Molecular Mass
6,149 Da
Purity
>95% by SDS-PAGE
Cost (US$)
$300
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Conway, K.A. et. al., (2000) Biochemistry, 39: 2552
2) Jakes, R. et al. (1994), FEBS Letters, 345: 27
3) Masliah, E. et. al., (2001) Proc. Natl. Acad. Sci., USA, 98: 12245
4) Ueda, K., et. al. (1993) Proc. Natl. Acad. Sci., USA, 90: 11282