Gamma-Synuclein, Mouse

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Gamma-Synuclein, Mouse
Size
Catalog #
S-1009-2
Storage
-20°C
Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTK EQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKS GED
Source
Recombinant. A DNA sequence encoding the human gamma-synuclein sequence was expressed in E. coli.
Description
Gamma-Synuclein (originally known as a breast cancer specific gene product, BCSG1) is an acidic neuronal protein of 127 amino acids. It is up-regulated in the majority of late-stage breast and ovarian cancers. Gamma-synuclein may be a potential marker for both late stage breast and ovarian cancers. More recently, it has been shown that gamma-synuclein promotes cancer cell survival and inhibits stress- and chemotherapy drug-induced apoptosis by modulating MAP kinase pathways.
Molecular Mass
13,300 Da
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$500
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Pan, Z.Z. et al. (2002) J. Biol. Chem, 277: 35050
2) Bruening, W. et al. (2000) Cancer 88: 2154
3) Ji, H. et al. (1997) Cancer Res. 57: 759