We understand these are trying times and we are here to help keep your research moving forward.

As we closely monitor the situation at hand, rPeptide will remain fully operational and continue to practice all safety protocol while taking precautionary measures to ensure there are no interruptions to your research. From our catalog products to our laboratory services, please let us know how we can assist with your research needs.

Gamma-Synuclein

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Gamma-Synuclein
Size
Catalog #
S-1007-2
Storage
-20°C
Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Source
Recombinant. A DNA sequence encoding the human gamma-synuclein sequence was expressed in E. coli.
Description
Gamma-Synuclein (originally known as a breast cancer specific gene product, BCSG1) is an acidic neuronal protein of 127 amino acids. It is up-regulated in the majority of late-stage breast and ovarian cancers. Gamma-synuclein may be a potential marker for both late stage breast and ovarian cancers. More recently, it has been shown that gamma-synuclein promotes cancer cell survival and inhibits stress- and chemotherapy drug- induced apoptosis by modulating MAP kinase pathways.
Molecular Mass
13,300 Da
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$500
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Pan, Z.Z. et al. (2002) J. Biol. Chem, 277: 35050
2) Bruening, W. et al. (2000) Cancer 88: 2154
3) Ji, H. et al. (1997) Cancer Res. 57: 759