Alpha-Synuclein, A30P mutant

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha-Synuclein, A30P mutant
Size
Catalog #
S-1005-1
Storage
-20°C
Sequence
MDVFMKGLSKAKEGVVAAAE KTKQGVAEAPGKTKEGVLYVGSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA
Source
Recombinant. A DNA sequence encoding the human alpha-synuclein, A30P mutant sequence was expressed in E. coli.
Description
A point mutant (A30P) of alpha-synuclein gene that has been linked to autosomal dominant early onset Parkinson’s Disease (PD). Alpha- Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of PD aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.
Molecular Mass
14,486 Da
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$300
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Lashuel, H.A., et. al., (2002), J Mol Biol. 322: 1089
2) Park, S.M., et. al., (2002) Blood, 100: 2506
3) Polymeropoulos, M.H., et. al., (1997), Science, 276: 2045