We understand these are trying times and we are here to help keep your research moving forward.

As we closely monitor the situation at hand, rPeptide will remain fully operational and continue to practice all safety protocol while taking precautionary measures to ensure there are no interruptions to your research. From our catalog products to our laboratory services, please let us know how we can assist with your research needs.

Alpha-Synuclein, A30P mutant

ORDER ONLINE  •  CALL 866.753.0747  •  FAX 678.753.0746

Product Name
Alpha-Synuclein, A30P mutant
Size
Catalog #
S-1005-1
Storage
-20°C
Sequence
MDVFMKGLSKAKEGVVAAAE KTKQGVAEAPGKTKEGVLYVGSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA
Source
Recombinant. A DNA sequence encoding the human alpha-synuclein, A30P mutant sequence was expressed in E. coli.
Description
A point mutant (A30P) of alpha-synuclein gene that has been linked to autosomal dominant early onset Parkinson’s Disease (PD). Alpha- Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of PD aggregates and is implicated in the pathogenesis of PD and related neurodegenerative disorders.
Molecular Mass
14,486 Da
Purity
>95% by SDS-PAGE and Mass Spec.
Cost (US$)
$300
Place an Order
Quantity

Would you like 10 or more?  Save on cost by requesting a Large Quantity Quote.

1) Lashuel, H.A., et. al., (2002), J Mol Biol. 322: 1089
2) Park, S.M., et. al., (2002) Blood, 100: 2506
3) Polymeropoulos, M.H., et. al., (1997), Science, 276: 2045